Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HF36

Protein Details
Accession A0A2I1HF36    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-45EDSIQPVKKKQKISRKKTSWIWEYHydrophilic
NLS Segment(s)
PositionSequence
30-36KKQKISR
Subcellular Location(s) nucl 16, mito_nucl 11.333, cyto_nucl 9.833, mito 5.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MTQQSSITPFLTAPSPNTPPYEDSIQPVKKKQKISRKKTSWIWEYFIEGFNDKDELIIICQVEGEEGKKCNVKLKHDGSTGNGISHLWSVHKITKDGKQPAVWINNKSLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.26
4 0.28
5 0.29
6 0.28
7 0.31
8 0.33
9 0.27
10 0.28
11 0.35
12 0.39
13 0.41
14 0.47
15 0.52
16 0.52
17 0.61
18 0.65
19 0.67
20 0.72
21 0.78
22 0.82
23 0.79
24 0.82
25 0.8
26 0.8
27 0.77
28 0.69
29 0.62
30 0.52
31 0.48
32 0.41
33 0.35
34 0.27
35 0.19
36 0.16
37 0.13
38 0.13
39 0.09
40 0.08
41 0.06
42 0.05
43 0.05
44 0.06
45 0.06
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.06
52 0.07
53 0.08
54 0.1
55 0.13
56 0.13
57 0.21
58 0.25
59 0.3
60 0.37
61 0.42
62 0.47
63 0.48
64 0.49
65 0.44
66 0.47
67 0.41
68 0.32
69 0.27
70 0.2
71 0.18
72 0.17
73 0.15
74 0.09
75 0.1
76 0.13
77 0.18
78 0.21
79 0.23
80 0.27
81 0.34
82 0.42
83 0.47
84 0.48
85 0.45
86 0.47
87 0.52
88 0.57
89 0.55
90 0.49