Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1DT63

Protein Details
Accession A0A2I1DT63    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
123-151ELIIKVPKKKTQDAKDPKRRNVKIIKGKLHydrophilic
NLS Segment(s)
PositionSequence
129-151PKKKTQDAKDPKRRNVKIIKGKL
Subcellular Location(s) nucl 18, cyto_nucl 15.5, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002068  A-crystallin/Hsp20_dom  
IPR008978  HSP20-like_chaperone  
IPR031107  Small_HSP  
Pfam View protein in Pfam  
PF00011  HSP20  
PROSITE View protein in PROSITE  
PS01031  SHSP  
CDD cd06464  ACD_sHsps-like  
Amino Acid Sequences MMIFDDFFDITSLPLLSGGTTCSSSYNSLPLNISSTSTHYIVRTELPGIPQNQISVDINEDGILDIRAERHSKEDKEKTKTKDEEDEIVKENWALKGKLYRSIKFPKEHVDVDGVKAELNNGELIIKVPKKKTQDAKDPKRRNVKIIKGKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.07
5 0.08
6 0.08
7 0.09
8 0.1
9 0.11
10 0.13
11 0.15
12 0.15
13 0.19
14 0.18
15 0.19
16 0.2
17 0.19
18 0.2
19 0.18
20 0.19
21 0.15
22 0.18
23 0.19
24 0.19
25 0.19
26 0.17
27 0.17
28 0.17
29 0.17
30 0.15
31 0.14
32 0.14
33 0.16
34 0.19
35 0.2
36 0.2
37 0.19
38 0.18
39 0.16
40 0.17
41 0.15
42 0.12
43 0.12
44 0.1
45 0.1
46 0.09
47 0.09
48 0.07
49 0.06
50 0.06
51 0.04
52 0.04
53 0.05
54 0.07
55 0.08
56 0.08
57 0.13
58 0.18
59 0.21
60 0.29
61 0.37
62 0.43
63 0.49
64 0.56
65 0.56
66 0.6
67 0.6
68 0.55
69 0.53
70 0.48
71 0.46
72 0.42
73 0.4
74 0.33
75 0.3
76 0.27
77 0.2
78 0.19
79 0.16
80 0.17
81 0.14
82 0.13
83 0.19
84 0.21
85 0.29
86 0.33
87 0.32
88 0.36
89 0.45
90 0.5
91 0.47
92 0.48
93 0.48
94 0.48
95 0.47
96 0.42
97 0.38
98 0.33
99 0.31
100 0.31
101 0.23
102 0.18
103 0.17
104 0.16
105 0.1
106 0.1
107 0.09
108 0.06
109 0.06
110 0.06
111 0.08
112 0.14
113 0.18
114 0.23
115 0.27
116 0.33
117 0.39
118 0.48
119 0.58
120 0.6
121 0.67
122 0.73
123 0.81
124 0.86
125 0.89
126 0.9
127 0.91
128 0.85
129 0.83
130 0.82
131 0.82