Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GCB8

Protein Details
Accession A0A2I1GCB8    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
41-66FCIDRCSKQKEKEKRLKISNLKKVKEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MAIIDDELIDKMTFWDCDYSKSKFTFIDLIKGIVPCEFWGFCIDRCSKQKEKEKRLKISNLKKVKENYNKDEYINPNRKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.16
3 0.15
4 0.21
5 0.25
6 0.28
7 0.31
8 0.31
9 0.32
10 0.27
11 0.28
12 0.3
13 0.27
14 0.29
15 0.25
16 0.25
17 0.24
18 0.24
19 0.22
20 0.14
21 0.14
22 0.08
23 0.09
24 0.08
25 0.07
26 0.09
27 0.1
28 0.11
29 0.16
30 0.17
31 0.21
32 0.25
33 0.32
34 0.36
35 0.44
36 0.53
37 0.59
38 0.68
39 0.73
40 0.79
41 0.81
42 0.83
43 0.84
44 0.84
45 0.84
46 0.84
47 0.83
48 0.76
49 0.74
50 0.71
51 0.72
52 0.72
53 0.7
54 0.68
55 0.66
56 0.66
57 0.61
58 0.63
59 0.6
60 0.61