Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1FYN3

Protein Details
Accession A0A2I1FYN3    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-28SDSSDEKKVKTKHQRRREDWEQSPVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 4.5, mito 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR005635  Inner_centromere_prot_ARK-bd  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0005819  C:spindle  
Pfam View protein in Pfam  
PF03941  INCENP_ARK-bind  
Amino Acid Sequences SYYSDSSDEKKVKTKHQRRREDWEQSPVLKATLIRQASIDPETIFGKVPPLNMDEIFEGREHKFRPRSSSADWTGLDALTVDEELEYKVYMGFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.7
3 0.76
4 0.85
5 0.83
6 0.88
7 0.87
8 0.86
9 0.8
10 0.78
11 0.72
12 0.62
13 0.57
14 0.47
15 0.38
16 0.28
17 0.23
18 0.17
19 0.2
20 0.19
21 0.17
22 0.17
23 0.17
24 0.18
25 0.19
26 0.17
27 0.1
28 0.11
29 0.11
30 0.11
31 0.11
32 0.08
33 0.1
34 0.1
35 0.1
36 0.1
37 0.1
38 0.11
39 0.11
40 0.12
41 0.11
42 0.11
43 0.11
44 0.1
45 0.12
46 0.11
47 0.15
48 0.16
49 0.23
50 0.29
51 0.31
52 0.38
53 0.42
54 0.46
55 0.48
56 0.55
57 0.51
58 0.5
59 0.47
60 0.42
61 0.37
62 0.31
63 0.25
64 0.17
65 0.13
66 0.08
67 0.08
68 0.06
69 0.05
70 0.05
71 0.06
72 0.07
73 0.07
74 0.06