Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1FWD2

Protein Details
Accession A0A2I1FWD2    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-30SENTTTIRPKRNYTKKPLDRLKRPRNGYMIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences SENTTTIRPKRNYTKKPLDRLKRPRNGYMIYMNEVYDDVKRKHPNLKFGELSSLIGVQWKEMSKAQQMPYHQKHEEEKAAYEAAKLAMSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.87
4 0.89
5 0.88
6 0.88
7 0.9
8 0.9
9 0.88
10 0.84
11 0.8
12 0.76
13 0.68
14 0.61
15 0.57
16 0.48
17 0.42
18 0.37
19 0.3
20 0.24
21 0.22
22 0.19
23 0.14
24 0.16
25 0.14
26 0.21
27 0.24
28 0.27
29 0.35
30 0.37
31 0.44
32 0.45
33 0.49
34 0.43
35 0.4
36 0.41
37 0.33
38 0.31
39 0.22
40 0.17
41 0.11
42 0.12
43 0.11
44 0.08
45 0.1
46 0.1
47 0.11
48 0.13
49 0.16
50 0.19
51 0.25
52 0.29
53 0.3
54 0.35
55 0.44
56 0.48
57 0.53
58 0.5
59 0.48
60 0.49
61 0.52
62 0.54
63 0.46
64 0.42
65 0.37
66 0.37
67 0.33
68 0.29
69 0.23
70 0.17