Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GAD0

Protein Details
Accession A0A2I1GAD0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MGIYKSYKRRFQLKNCNKIRLEKQKKSQRDKIINEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MGIYKSYKRRFQLKNCNKIRLEKQKKSQRDKIINEIKNNQRFLNSLLNNYNKIIVKLLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.84
4 0.76
5 0.74
6 0.74
7 0.73
8 0.73
9 0.71
10 0.75
11 0.76
12 0.83
13 0.84
14 0.83
15 0.81
16 0.8
17 0.75
18 0.75
19 0.75
20 0.7
21 0.66
22 0.65
23 0.64
24 0.6
25 0.58
26 0.49
27 0.4
28 0.37
29 0.37
30 0.39
31 0.32
32 0.3
33 0.35
34 0.38
35 0.38
36 0.38
37 0.39
38 0.3
39 0.3