Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HSU5

Protein Details
Accession A0A2I1HSU5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-33CESALQVNKKNRKRKSGEAFREDFHydrophilic
NLS Segment(s)
PositionSequence
19-24KNRKRK
Subcellular Location(s) nucl 14, mito_nucl 11.666, cyto_nucl 9.666, mito 8, cyto_mito 6.666
Family & Domain DBs
Amino Acid Sequences MGFAQNLVQCESALQVNKKNRKRKSGEAFREDFDYIYGIVTTASEWYFILFASDGISSTSKDPLNIRFTESALKDRLEEEKDLCKNVKRVMEVVVGLLKDRLECVGEEPDRKKAKIEEYHLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.28
3 0.37
4 0.48
5 0.56
6 0.64
7 0.68
8 0.73
9 0.78
10 0.8
11 0.82
12 0.83
13 0.84
14 0.83
15 0.78
16 0.68
17 0.64
18 0.54
19 0.43
20 0.31
21 0.22
22 0.14
23 0.11
24 0.1
25 0.06
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.06
35 0.05
36 0.06
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.06
43 0.07
44 0.07
45 0.08
46 0.11
47 0.1
48 0.11
49 0.12
50 0.16
51 0.2
52 0.2
53 0.22
54 0.2
55 0.2
56 0.24
57 0.24
58 0.22
59 0.2
60 0.2
61 0.17
62 0.18
63 0.21
64 0.19
65 0.19
66 0.18
67 0.24
68 0.25
69 0.27
70 0.29
71 0.29
72 0.3
73 0.34
74 0.36
75 0.3
76 0.3
77 0.31
78 0.31
79 0.27
80 0.24
81 0.22
82 0.17
83 0.15
84 0.15
85 0.12
86 0.09
87 0.09
88 0.09
89 0.08
90 0.08
91 0.11
92 0.19
93 0.22
94 0.29
95 0.31
96 0.4
97 0.44
98 0.44
99 0.45
100 0.43
101 0.49
102 0.52
103 0.58