Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HSC0

Protein Details
Accession A0A2I1HSC0   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-61MPRTYRKTKKSFVKVSNNNNHPNKSKTRKVPCNCDKCKGILVDSRTKKSHELKKNIRPRGIHydrophilic
111-132TYTFLPKKLPKDKPKGKQKDIGHydrophilic
NLS Segment(s)
PositionSequence
117-127KKLPKDKPKGK
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MPRTYRKTKKSFVKVSNNNNHPNKSKTRKVPCNCDKCKGILVDSRTKKSHELKKNIRPRGIIENTDLNQDSTNDPSLDESVDLSDRLDSMEVDDNDQMMIESNQPSSQRETYTFLPKKLPKDKPKGKQKDIGSGGITYPIVVIEQNISDYDDDGDADGDDSESVDDELNFTEENPNESSSSGFDAPETDDIYDDIEVPIVDFNESFNWI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.9
4 0.87
5 0.86
6 0.82
7 0.78
8 0.73
9 0.7
10 0.7
11 0.68
12 0.7
13 0.7
14 0.75
15 0.79
16 0.82
17 0.87
18 0.87
19 0.88
20 0.84
21 0.81
22 0.73
23 0.65
24 0.62
25 0.53
26 0.47
27 0.42
28 0.43
29 0.46
30 0.49
31 0.51
32 0.48
33 0.48
34 0.5
35 0.53
36 0.58
37 0.58
38 0.62
39 0.67
40 0.75
41 0.83
42 0.84
43 0.78
44 0.7
45 0.64
46 0.63
47 0.58
48 0.5
49 0.43
50 0.41
51 0.38
52 0.39
53 0.35
54 0.25
55 0.21
56 0.2
57 0.18
58 0.14
59 0.15
60 0.12
61 0.11
62 0.12
63 0.12
64 0.11
65 0.1
66 0.08
67 0.07
68 0.07
69 0.07
70 0.07
71 0.06
72 0.06
73 0.06
74 0.06
75 0.05
76 0.06
77 0.12
78 0.12
79 0.13
80 0.13
81 0.13
82 0.12
83 0.12
84 0.1
85 0.05
86 0.06
87 0.05
88 0.06
89 0.06
90 0.08
91 0.09
92 0.1
93 0.13
94 0.14
95 0.14
96 0.15
97 0.19
98 0.21
99 0.31
100 0.32
101 0.3
102 0.36
103 0.39
104 0.45
105 0.51
106 0.57
107 0.56
108 0.65
109 0.73
110 0.76
111 0.83
112 0.85
113 0.81
114 0.79
115 0.72
116 0.71
117 0.65
118 0.57
119 0.47
120 0.38
121 0.33
122 0.26
123 0.23
124 0.13
125 0.1
126 0.07
127 0.06
128 0.05
129 0.05
130 0.05
131 0.05
132 0.06
133 0.06
134 0.07
135 0.07
136 0.07
137 0.08
138 0.07
139 0.07
140 0.07
141 0.07
142 0.06
143 0.06
144 0.06
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.06
154 0.06
155 0.07
156 0.07
157 0.08
158 0.12
159 0.12
160 0.15
161 0.17
162 0.18
163 0.17
164 0.18
165 0.18
166 0.14
167 0.18
168 0.16
169 0.14
170 0.13
171 0.14
172 0.16
173 0.17
174 0.17
175 0.13
176 0.12
177 0.13
178 0.14
179 0.13
180 0.11
181 0.09
182 0.09
183 0.08
184 0.08
185 0.09
186 0.08
187 0.09
188 0.08
189 0.09