Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1H880

Protein Details
Accession A0A2I1H880    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
43-72GGGLYDYKNKKHKKKKHKNKNYSRHFINKRBasic
NLS Segment(s)
PositionSequence
50-63KNKKHKKKKHKNKN
Subcellular Location(s) mito 14.5, mito_nucl 10.5, nucl 5.5, extr 4
Family & Domain DBs
Amino Acid Sequences MRKHNLIVLIAIVIILCLTTLSNGAVIKSNLVKRKQDTPYSTGGGLYDYKNKKHKKKKHKNKNYSRHFINKRDENKEDKDPDLGEVSVRQEEKAHLQKRQTPPVSTGHVDAGKTTPGKSGNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.04
8 0.05
9 0.07
10 0.07
11 0.08
12 0.11
13 0.11
14 0.13
15 0.18
16 0.23
17 0.28
18 0.32
19 0.37
20 0.37
21 0.47
22 0.51
23 0.54
24 0.53
25 0.5
26 0.5
27 0.47
28 0.44
29 0.35
30 0.28
31 0.22
32 0.18
33 0.16
34 0.19
35 0.2
36 0.25
37 0.33
38 0.41
39 0.5
40 0.6
41 0.69
42 0.72
43 0.81
44 0.88
45 0.91
46 0.94
47 0.95
48 0.95
49 0.96
50 0.94
51 0.9
52 0.84
53 0.82
54 0.78
55 0.75
56 0.72
57 0.7
58 0.67
59 0.66
60 0.65
61 0.6
62 0.58
63 0.58
64 0.52
65 0.45
66 0.4
67 0.34
68 0.31
69 0.27
70 0.22
71 0.15
72 0.13
73 0.14
74 0.15
75 0.15
76 0.14
77 0.13
78 0.15
79 0.23
80 0.31
81 0.34
82 0.36
83 0.41
84 0.5
85 0.57
86 0.66
87 0.62
88 0.55
89 0.54
90 0.55
91 0.55
92 0.48
93 0.42
94 0.37
95 0.34
96 0.32
97 0.3
98 0.25
99 0.24
100 0.24
101 0.23
102 0.22