Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3NXY2

Protein Details
Accession J3NXY2    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
188-214LDKVKERWGPKKIKAREDRDRRRGMMFBasic
NLS Segment(s)
PositionSequence
192-210KERWGPKKIKAREDRDRRR
Subcellular Location(s) mito 21, nucl 3, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR024388  Ribosomal_L20_mt  
Pfam View protein in Pfam  
PF12824  MRP-L20  
Amino Acid Sequences MEAQLLLRTATSRPLVATSRLGSRAPLLCQQQRRTKLTSNRLKRALNIPPHPDFLVDPSRSQGDVVIFNPPASEPSVYHTPFKFLPKNDPRRRSNLANLFTSVYPSKSSHTGDAAALPVDSLPAVKSSTSRLVTEAEVREMREKRLSDPKRWSVTVLAREYKTTKPFVMLATGTAKMTAHKREMQAELDKVKERWGPKKIKAREDRDRRRGMMFNGEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.25
4 0.29
5 0.26
6 0.29
7 0.31
8 0.3
9 0.27
10 0.29
11 0.29
12 0.28
13 0.32
14 0.35
15 0.4
16 0.48
17 0.55
18 0.59
19 0.64
20 0.65
21 0.65
22 0.66
23 0.69
24 0.71
25 0.74
26 0.74
27 0.75
28 0.78
29 0.73
30 0.68
31 0.66
32 0.64
33 0.63
34 0.59
35 0.57
36 0.53
37 0.54
38 0.5
39 0.43
40 0.34
41 0.3
42 0.31
43 0.26
44 0.23
45 0.23
46 0.24
47 0.23
48 0.22
49 0.19
50 0.13
51 0.15
52 0.15
53 0.17
54 0.16
55 0.15
56 0.15
57 0.13
58 0.12
59 0.12
60 0.12
61 0.08
62 0.13
63 0.2
64 0.22
65 0.25
66 0.24
67 0.25
68 0.26
69 0.32
70 0.32
71 0.27
72 0.36
73 0.44
74 0.55
75 0.62
76 0.68
77 0.65
78 0.68
79 0.72
80 0.66
81 0.64
82 0.62
83 0.56
84 0.48
85 0.45
86 0.4
87 0.34
88 0.31
89 0.23
90 0.15
91 0.14
92 0.13
93 0.13
94 0.15
95 0.16
96 0.15
97 0.15
98 0.16
99 0.14
100 0.14
101 0.12
102 0.09
103 0.08
104 0.06
105 0.05
106 0.04
107 0.04
108 0.03
109 0.03
110 0.04
111 0.05
112 0.05
113 0.06
114 0.09
115 0.15
116 0.16
117 0.16
118 0.17
119 0.18
120 0.19
121 0.23
122 0.21
123 0.19
124 0.18
125 0.19
126 0.24
127 0.24
128 0.25
129 0.26
130 0.26
131 0.28
132 0.38
133 0.42
134 0.43
135 0.51
136 0.57
137 0.57
138 0.57
139 0.53
140 0.49
141 0.51
142 0.51
143 0.47
144 0.43
145 0.39
146 0.41
147 0.42
148 0.41
149 0.38
150 0.34
151 0.29
152 0.26
153 0.27
154 0.26
155 0.27
156 0.21
157 0.2
158 0.2
159 0.2
160 0.17
161 0.16
162 0.15
163 0.15
164 0.2
165 0.22
166 0.24
167 0.29
168 0.32
169 0.36
170 0.39
171 0.41
172 0.42
173 0.42
174 0.4
175 0.39
176 0.4
177 0.36
178 0.37
179 0.37
180 0.38
181 0.42
182 0.48
183 0.53
184 0.59
185 0.7
186 0.73
187 0.79
188 0.83
189 0.83
190 0.85
191 0.87
192 0.89
193 0.88
194 0.88
195 0.8
196 0.76
197 0.73
198 0.66