Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1H779

Protein Details
Accession A0A2I1H779    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
111-138NNSAGPSRPRNNDQRRKPKKQGNNFDAMHydrophilic
NLS Segment(s)
PositionSequence
125-130RRKPKK
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences SNPSTRRPTRQFNNNDFAPESNPSTRRPTRPFNNNDFAPESNPSTRRPTRQFNNNDFAPESNPSTRRPTRQFNNNDFAPESNPSTRRPTRPFNNNDFAPEPNSSAGRSSNNNSAGPSRPRNNDQRRKPKKQGNNFDAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.67
3 0.58
4 0.5
5 0.42
6 0.36
7 0.32
8 0.31
9 0.31
10 0.31
11 0.39
12 0.44
13 0.49
14 0.53
15 0.58
16 0.61
17 0.69
18 0.74
19 0.73
20 0.74
21 0.66
22 0.63
23 0.57
24 0.48
25 0.41
26 0.37
27 0.33
28 0.32
29 0.33
30 0.33
31 0.38
32 0.42
33 0.46
34 0.51
35 0.57
36 0.6
37 0.68
38 0.75
39 0.74
40 0.77
41 0.71
42 0.67
43 0.58
44 0.5
45 0.42
46 0.36
47 0.32
48 0.31
49 0.31
50 0.31
51 0.39
52 0.42
53 0.46
54 0.51
55 0.57
56 0.6
57 0.68
58 0.75
59 0.74
60 0.77
61 0.71
62 0.67
63 0.58
64 0.5
65 0.42
66 0.36
67 0.32
68 0.31
69 0.31
70 0.31
71 0.39
72 0.44
73 0.49
74 0.53
75 0.58
76 0.61
77 0.69
78 0.74
79 0.73
80 0.74
81 0.66
82 0.64
83 0.56
84 0.48
85 0.41
86 0.34
87 0.27
88 0.21
89 0.21
90 0.17
91 0.16
92 0.17
93 0.17
94 0.2
95 0.23
96 0.28
97 0.31
98 0.31
99 0.31
100 0.32
101 0.35
102 0.39
103 0.43
104 0.43
105 0.46
106 0.53
107 0.62
108 0.7
109 0.74
110 0.78
111 0.81
112 0.85
113 0.89
114 0.93
115 0.92
116 0.92
117 0.92
118 0.93