Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GP28

Protein Details
Accession A0A2I1GP28    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MNSFKKRFKSTSTKKLRTRLEREFNDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 12.5, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MNSFKKRFKSTSTKKLRTRLEREFNDFTNSYNEIFNQNFRDYVNVKYYEPYIGSDTSEETRELEHRPNKRPAYENNNLNNTQLLHSSKKTRAVSNSTDTAEETTHIEIDWFPDLYNTDSCDNLIESF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.87
4 0.86
5 0.84
6 0.84
7 0.83
8 0.79
9 0.79
10 0.74
11 0.66
12 0.61
13 0.52
14 0.43
15 0.37
16 0.32
17 0.25
18 0.21
19 0.2
20 0.18
21 0.19
22 0.21
23 0.2
24 0.2
25 0.19
26 0.19
27 0.22
28 0.2
29 0.22
30 0.25
31 0.23
32 0.22
33 0.23
34 0.23
35 0.2
36 0.19
37 0.17
38 0.14
39 0.12
40 0.12
41 0.12
42 0.12
43 0.12
44 0.13
45 0.11
46 0.09
47 0.09
48 0.11
49 0.12
50 0.18
51 0.23
52 0.28
53 0.34
54 0.42
55 0.44
56 0.46
57 0.48
58 0.48
59 0.51
60 0.53
61 0.55
62 0.52
63 0.54
64 0.51
65 0.47
66 0.41
67 0.33
68 0.26
69 0.22
70 0.19
71 0.18
72 0.21
73 0.26
74 0.28
75 0.36
76 0.38
77 0.39
78 0.42
79 0.44
80 0.47
81 0.47
82 0.47
83 0.4
84 0.38
85 0.34
86 0.29
87 0.23
88 0.19
89 0.15
90 0.12
91 0.11
92 0.1
93 0.1
94 0.09
95 0.11
96 0.12
97 0.11
98 0.1
99 0.11
100 0.13
101 0.15
102 0.17
103 0.18
104 0.17
105 0.17
106 0.18
107 0.18