Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NTP4

Protein Details
Accession J3NTP4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-40SARPWASVKVRRRRKWITRRGSTAAHydrophilic
NLS Segment(s)
PositionSequence
10-35LGRRGGSARPWASVKVRRRRKWITRR
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MSWPRPDRELGRRGGSARPWASVKVRRRRKWITRRGSTAAGGLLMAVPRPAQTYFSLSLFRGFLSKPTTSCSQPETPTPTWQPRTYLLANIPYSSTTTNTARHQTSHPTAQETLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.47
4 0.41
5 0.39
6 0.36
7 0.36
8 0.41
9 0.45
10 0.5
11 0.52
12 0.62
13 0.66
14 0.73
15 0.8
16 0.83
17 0.86
18 0.87
19 0.87
20 0.84
21 0.84
22 0.79
23 0.71
24 0.61
25 0.51
26 0.4
27 0.29
28 0.2
29 0.13
30 0.09
31 0.06
32 0.05
33 0.04
34 0.04
35 0.04
36 0.06
37 0.06
38 0.08
39 0.09
40 0.12
41 0.14
42 0.15
43 0.16
44 0.15
45 0.15
46 0.14
47 0.13
48 0.1
49 0.09
50 0.1
51 0.13
52 0.14
53 0.13
54 0.17
55 0.2
56 0.2
57 0.22
58 0.25
59 0.25
60 0.25
61 0.29
62 0.33
63 0.32
64 0.36
65 0.4
66 0.43
67 0.44
68 0.44
69 0.43
70 0.38
71 0.42
72 0.38
73 0.36
74 0.32
75 0.34
76 0.33
77 0.31
78 0.28
79 0.23
80 0.23
81 0.2
82 0.19
83 0.16
84 0.19
85 0.23
86 0.27
87 0.33
88 0.33
89 0.35
90 0.37
91 0.41
92 0.44
93 0.48
94 0.46
95 0.45