Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AM08

Protein Details
Accession G3AM08   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
25-45GPNRYIGKKPLRKPDARNRGVBasic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12.333, cyto 6, cyto_mito 4.499, cysk 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR042171  Acyl-CoA_hotdog  
IPR003703  Acyl_CoA_thio  
IPR029069  HotDog_dom_sf  
Gene Ontology GO:0047617  F:acyl-CoA hydrolase activity  
GO:0006637  P:acyl-CoA metabolic process  
KEGG spaa:SPAPADRAFT_60699  -  
Pfam View protein in Pfam  
PF13622  4HBT_3  
CDD cd03445  Thioesterase_II_repeat2  
Amino Acid Sequences MEQATASDDIVPVDIPSELGVDEIGPNRYIGKKPLRKPDARNRGVYGGSLCAQAILVAMKSSPPGFRPHSLHSYFVKSVDEDTPVVWEVQEISNGRNFVNRMISAIQYDKLVYTANISLTLKNSKSGSKEEEFSFQTPRDENFEKFKSDNLHIYEANPNLYIYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.06
6 0.06
7 0.06
8 0.05
9 0.07
10 0.09
11 0.11
12 0.1
13 0.11
14 0.13
15 0.17
16 0.18
17 0.24
18 0.33
19 0.41
20 0.48
21 0.59
22 0.65
23 0.69
24 0.77
25 0.8
26 0.81
27 0.77
28 0.73
29 0.66
30 0.6
31 0.53
32 0.45
33 0.35
34 0.26
35 0.22
36 0.18
37 0.14
38 0.1
39 0.1
40 0.08
41 0.07
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.05
48 0.06
49 0.07
50 0.08
51 0.13
52 0.17
53 0.21
54 0.26
55 0.29
56 0.36
57 0.37
58 0.39
59 0.36
60 0.37
61 0.33
62 0.29
63 0.25
64 0.18
65 0.18
66 0.16
67 0.15
68 0.1
69 0.1
70 0.1
71 0.1
72 0.09
73 0.07
74 0.06
75 0.06
76 0.06
77 0.09
78 0.09
79 0.09
80 0.12
81 0.12
82 0.12
83 0.14
84 0.14
85 0.13
86 0.15
87 0.15
88 0.14
89 0.15
90 0.15
91 0.14
92 0.15
93 0.14
94 0.11
95 0.12
96 0.1
97 0.09
98 0.09
99 0.07
100 0.08
101 0.09
102 0.09
103 0.12
104 0.13
105 0.13
106 0.15
107 0.2
108 0.19
109 0.2
110 0.22
111 0.22
112 0.25
113 0.29
114 0.32
115 0.31
116 0.34
117 0.33
118 0.36
119 0.36
120 0.35
121 0.34
122 0.29
123 0.29
124 0.28
125 0.28
126 0.3
127 0.3
128 0.32
129 0.36
130 0.38
131 0.39
132 0.37
133 0.4
134 0.38
135 0.39
136 0.43
137 0.39
138 0.41
139 0.37
140 0.39
141 0.41
142 0.37
143 0.35
144 0.29