Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HEY3

Protein Details
Accession A0A2I1HEY3    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
57-89KLEKVYKEIPDKNKNKKKKSKKSKKSKKNSMIFBasic
NLS Segment(s)
PositionSequence
60-84KVYKEIPDKNKNKKKKSKKSKKSKK
Subcellular Location(s) nucl 15.5, mito_nucl 11.5, mito 6.5, pero 3
Family & Domain DBs
Amino Acid Sequences MSGILWPLENSLKKAATKSWTGEMAWDVDKDGVIFEYTKAKHTTHDCKCTNDKKPWKLEKVYKEIPDKNKNKKKKSKKSKKSKKNSMIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.3
4 0.32
5 0.33
6 0.32
7 0.31
8 0.3
9 0.29
10 0.25
11 0.23
12 0.2
13 0.17
14 0.13
15 0.11
16 0.11
17 0.09
18 0.08
19 0.06
20 0.06
21 0.06
22 0.06
23 0.12
24 0.13
25 0.16
26 0.18
27 0.18
28 0.21
29 0.27
30 0.36
31 0.37
32 0.45
33 0.44
34 0.47
35 0.55
36 0.59
37 0.6
38 0.6
39 0.63
40 0.62
41 0.7
42 0.74
43 0.73
44 0.73
45 0.74
46 0.72
47 0.72
48 0.71
49 0.67
50 0.67
51 0.67
52 0.69
53 0.71
54 0.72
55 0.74
56 0.78
57 0.81
58 0.84
59 0.88
60 0.9
61 0.91
62 0.94
63 0.94
64 0.95
65 0.96
66 0.97
67 0.97
68 0.97
69 0.97