Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1H233

Protein Details
Accession A0A2I1H233    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
35-54NIYPLSPSKKQRRHDSNSIFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 13.833, mito_nucl 13.666
Family & Domain DBs
Amino Acid Sequences MSENEDIGKLKDISNKIWKERNIQGKRNKYMSKENIYPLSPSKKQRRHDSNSIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.43
4 0.5
5 0.5
6 0.49
7 0.55
8 0.59
9 0.58
10 0.61
11 0.65
12 0.67
13 0.69
14 0.7
15 0.66
16 0.59
17 0.61
18 0.6
19 0.58
20 0.53
21 0.51
22 0.48
23 0.46
24 0.44
25 0.39
26 0.4
27 0.39
28 0.45
29 0.52
30 0.57
31 0.64
32 0.73
33 0.78
34 0.79