Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HX54

Protein Details
Accession A0A2I1HX54    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
48-83GGEKTKKGKGKNERKGKKKTKEREREKNEKEKEKENBasic
NLS Segment(s)
PositionSequence
21-86KGKGRKREGAKRKEDEKERDMGKKERKGGEKTKKGKGKNERKGKKKTKEREREKNEKEKEKENLQK
Subcellular Location(s) nucl 18, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MVSLRKFKGKRFTKTEECLEKGKGRKREGAKRKEDEKERDMGKKERKGGEKTKKGKGKNERKGKKKTKEREREKNEKEKEKENLQKKVLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.75
4 0.69
5 0.63
6 0.59
7 0.56
8 0.55
9 0.57
10 0.56
11 0.52
12 0.57
13 0.62
14 0.68
15 0.72
16 0.74
17 0.76
18 0.75
19 0.78
20 0.78
21 0.77
22 0.73
23 0.66
24 0.62
25 0.56
26 0.54
27 0.51
28 0.5
29 0.5
30 0.49
31 0.52
32 0.51
33 0.54
34 0.55
35 0.61
36 0.64
37 0.66
38 0.66
39 0.7
40 0.71
41 0.7
42 0.72
43 0.73
44 0.73
45 0.74
46 0.79
47 0.79
48 0.82
49 0.88
50 0.89
51 0.89
52 0.89
53 0.89
54 0.89
55 0.91
56 0.92
57 0.93
58 0.92
59 0.92
60 0.9
61 0.9
62 0.89
63 0.88
64 0.82
65 0.79
66 0.77
67 0.76
68 0.77
69 0.76
70 0.75