Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GI65

Protein Details
Accession A0A2I1GI65    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
163-188NIKQLKSTCETNKRKRKRGDNDFDYLHydrophilic
NLS Segment(s)
PositionSequence
176-179RKRK
Subcellular Location(s) nucl 16, cyto_nucl 12.833, mito_nucl 10.999, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MSETSTPYTPASTSTSVAGNETLRSIGLSLGPALNIAVFAKECKDKKLKAFYPVLLPPTYEIQDSNKVFKRCMEDILGRLCSYGTLQPDSLEAMRNDYVVALLHASIYIVMDETNKELSMRPQYGIVGEESKGRVDYAIKEAEDLICITEDKQHKVPVGFAQNIKQLKSTCETNKRKRKRGDNDFDYLYGIITTGQDWHFLLYSPGKISKASDTAYSIEFTRKALDLNSNSYKLLCNSVKEVLGIIVGLLKDRACAEEESDRKRARIEEYRLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.21
4 0.22
5 0.22
6 0.17
7 0.16
8 0.15
9 0.14
10 0.11
11 0.11
12 0.1
13 0.09
14 0.09
15 0.09
16 0.09
17 0.09
18 0.09
19 0.09
20 0.09
21 0.08
22 0.07
23 0.06
24 0.06
25 0.06
26 0.07
27 0.11
28 0.19
29 0.2
30 0.27
31 0.35
32 0.39
33 0.47
34 0.58
35 0.59
36 0.6
37 0.64
38 0.59
39 0.59
40 0.57
41 0.52
42 0.41
43 0.37
44 0.3
45 0.28
46 0.26
47 0.2
48 0.17
49 0.18
50 0.26
51 0.27
52 0.33
53 0.36
54 0.36
55 0.36
56 0.39
57 0.42
58 0.35
59 0.36
60 0.34
61 0.3
62 0.32
63 0.37
64 0.34
65 0.27
66 0.25
67 0.22
68 0.17
69 0.15
70 0.15
71 0.13
72 0.13
73 0.13
74 0.14
75 0.14
76 0.16
77 0.15
78 0.15
79 0.12
80 0.14
81 0.14
82 0.14
83 0.13
84 0.11
85 0.11
86 0.08
87 0.08
88 0.05
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.03
96 0.03
97 0.03
98 0.04
99 0.04
100 0.05
101 0.06
102 0.06
103 0.07
104 0.07
105 0.1
106 0.16
107 0.17
108 0.16
109 0.16
110 0.16
111 0.17
112 0.17
113 0.14
114 0.1
115 0.09
116 0.1
117 0.1
118 0.1
119 0.09
120 0.08
121 0.08
122 0.08
123 0.09
124 0.11
125 0.12
126 0.12
127 0.12
128 0.12
129 0.12
130 0.11
131 0.1
132 0.07
133 0.05
134 0.05
135 0.05
136 0.11
137 0.13
138 0.15
139 0.18
140 0.19
141 0.21
142 0.21
143 0.23
144 0.22
145 0.25
146 0.25
147 0.24
148 0.25
149 0.29
150 0.29
151 0.28
152 0.26
153 0.22
154 0.21
155 0.24
156 0.27
157 0.29
158 0.39
159 0.48
160 0.56
161 0.67
162 0.74
163 0.8
164 0.83
165 0.86
166 0.87
167 0.88
168 0.88
169 0.83
170 0.78
171 0.71
172 0.62
173 0.52
174 0.41
175 0.3
176 0.19
177 0.13
178 0.08
179 0.06
180 0.06
181 0.07
182 0.07
183 0.08
184 0.09
185 0.09
186 0.09
187 0.09
188 0.12
189 0.12
190 0.13
191 0.14
192 0.16
193 0.16
194 0.17
195 0.18
196 0.2
197 0.21
198 0.21
199 0.2
200 0.2
201 0.21
202 0.22
203 0.21
204 0.18
205 0.18
206 0.17
207 0.16
208 0.16
209 0.15
210 0.15
211 0.16
212 0.23
213 0.23
214 0.3
215 0.35
216 0.34
217 0.34
218 0.34
219 0.33
220 0.27
221 0.32
222 0.27
223 0.24
224 0.26
225 0.29
226 0.29
227 0.27
228 0.26
229 0.18
230 0.16
231 0.13
232 0.09
233 0.08
234 0.07
235 0.08
236 0.08
237 0.08
238 0.09
239 0.1
240 0.11
241 0.12
242 0.13
243 0.17
244 0.25
245 0.32
246 0.37
247 0.45
248 0.46
249 0.44
250 0.47
251 0.46
252 0.46
253 0.5
254 0.53