Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3P6R8

Protein Details
Accession J3P6R8    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
111-138NVPTNRRLGRCRPPPRARPRRANLEREGHydrophilic
NLS Segment(s)
PositionSequence
122-131RPPPRARPRR
Subcellular Location(s) nucl 12, mito 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MPPSRATVVGQRPTEPSGSLNQLSAALGSPIFTIGAAILSSRRPLPCEISADVAWMLAVQHQCIIAQALGPRGASTMPPAPRPSPAPPHKPRAPPAVLSNQRAADAAQHVNVPTNRRLGRCRPPPRARPRRANLEREGSDGQDSTIIDTARDVTASPNWTCKAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.33
3 0.26
4 0.23
5 0.27
6 0.26
7 0.23
8 0.21
9 0.2
10 0.19
11 0.18
12 0.13
13 0.08
14 0.07
15 0.07
16 0.06
17 0.06
18 0.06
19 0.05
20 0.05
21 0.04
22 0.05
23 0.04
24 0.05
25 0.06
26 0.06
27 0.08
28 0.11
29 0.12
30 0.13
31 0.16
32 0.21
33 0.23
34 0.26
35 0.26
36 0.27
37 0.27
38 0.26
39 0.23
40 0.18
41 0.14
42 0.1
43 0.08
44 0.07
45 0.07
46 0.06
47 0.07
48 0.07
49 0.07
50 0.07
51 0.08
52 0.05
53 0.06
54 0.07
55 0.08
56 0.09
57 0.09
58 0.08
59 0.08
60 0.08
61 0.07
62 0.08
63 0.12
64 0.13
65 0.16
66 0.18
67 0.18
68 0.2
69 0.23
70 0.24
71 0.29
72 0.34
73 0.42
74 0.45
75 0.53
76 0.58
77 0.59
78 0.59
79 0.57
80 0.53
81 0.45
82 0.44
83 0.46
84 0.45
85 0.42
86 0.41
87 0.34
88 0.32
89 0.3
90 0.25
91 0.17
92 0.16
93 0.14
94 0.12
95 0.12
96 0.12
97 0.16
98 0.18
99 0.2
100 0.19
101 0.25
102 0.28
103 0.3
104 0.36
105 0.4
106 0.49
107 0.56
108 0.64
109 0.67
110 0.74
111 0.81
112 0.87
113 0.9
114 0.89
115 0.89
116 0.87
117 0.87
118 0.86
119 0.83
120 0.79
121 0.77
122 0.69
123 0.63
124 0.57
125 0.47
126 0.4
127 0.32
128 0.26
129 0.19
130 0.18
131 0.14
132 0.16
133 0.14
134 0.13
135 0.13
136 0.15
137 0.13
138 0.13
139 0.11
140 0.11
141 0.16
142 0.21
143 0.21
144 0.26