Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GYS6

Protein Details
Accession A0A2I1GYS6    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-34VPSDNFNRVIHKRRRRRVINKIHGNTFNHydrophilic
NLS Segment(s)
PositionSequence
18-23KRRRRR
Subcellular Location(s) plas 15, nucl 6.5, cyto_nucl 4.5, mito 2, cyto 1.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MMLKNHVPSDNFNRVIHKRRRRRVINKIHGNTFNVNTLSRLPLQITNDPFAVQLFSGASFHKITKREIFSSFGVDGVDSVDGVDGPSDGLFNLQQFKLLLFTLLLLSPLDSLLPESFLLGFVGTSGVVSLVCSRVYIYIYKPKKVNKILSIDVKNINLLPLDAFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.6
3 0.64
4 0.66
5 0.68
6 0.75
7 0.84
8 0.87
9 0.91
10 0.92
11 0.92
12 0.93
13 0.93
14 0.89
15 0.85
16 0.77
17 0.7
18 0.63
19 0.53
20 0.46
21 0.36
22 0.31
23 0.25
24 0.23
25 0.22
26 0.19
27 0.18
28 0.16
29 0.18
30 0.22
31 0.26
32 0.27
33 0.26
34 0.25
35 0.25
36 0.23
37 0.19
38 0.16
39 0.1
40 0.08
41 0.06
42 0.06
43 0.06
44 0.07
45 0.09
46 0.09
47 0.11
48 0.15
49 0.17
50 0.2
51 0.26
52 0.29
53 0.3
54 0.31
55 0.33
56 0.29
57 0.31
58 0.27
59 0.21
60 0.17
61 0.14
62 0.12
63 0.08
64 0.07
65 0.04
66 0.04
67 0.03
68 0.03
69 0.03
70 0.03
71 0.02
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.04
78 0.04
79 0.07
80 0.07
81 0.08
82 0.08
83 0.08
84 0.09
85 0.09
86 0.08
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.04
98 0.05
99 0.05
100 0.06
101 0.06
102 0.06
103 0.06
104 0.07
105 0.07
106 0.06
107 0.05
108 0.04
109 0.05
110 0.04
111 0.04
112 0.03
113 0.04
114 0.03
115 0.04
116 0.05
117 0.06
118 0.06
119 0.07
120 0.07
121 0.08
122 0.1
123 0.12
124 0.16
125 0.25
126 0.3
127 0.36
128 0.41
129 0.47
130 0.55
131 0.61
132 0.65
133 0.63
134 0.66
135 0.67
136 0.72
137 0.68
138 0.63
139 0.59
140 0.51
141 0.45
142 0.37
143 0.31
144 0.22
145 0.18