Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GXG8

Protein Details
Accession A0A2I1GXG8   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
189-214ATKKRCVEEITRKNRRHKSAVIKYRPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14.333, mito_nucl 12.166
Family & Domain DBs
Amino Acid Sequences MKELQSGQAGSNILHDQLQVRLETQEVNWPYLKEELERHGMKLGPATVLADFAKECKEKKLKSFSSYKTKKDLNEVLEKYEIVSGDIIRIPLFIPPPPNLSYALRHSPYGSSCSRGQTKSGDCGYLLQCRSACDMNIKYNKKNIEGIYSTSSTEDALKDDTELRRNVKRVLEVIVGKLKDRVEGSEEPATKKRCVEEITRKNRRHKSAVIKYRPPFLNGLELDAFFQKYRIALEVQGAQHRLHSTSWYKDVKKLEYIVNRDRQKRCICLESG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.14
4 0.16
5 0.18
6 0.15
7 0.15
8 0.15
9 0.15
10 0.16
11 0.15
12 0.21
13 0.21
14 0.23
15 0.24
16 0.24
17 0.25
18 0.27
19 0.28
20 0.22
21 0.24
22 0.25
23 0.32
24 0.33
25 0.32
26 0.32
27 0.32
28 0.29
29 0.29
30 0.25
31 0.17
32 0.16
33 0.17
34 0.13
35 0.14
36 0.13
37 0.11
38 0.09
39 0.1
40 0.15
41 0.17
42 0.18
43 0.25
44 0.34
45 0.37
46 0.46
47 0.56
48 0.56
49 0.6
50 0.68
51 0.67
52 0.7
53 0.73
54 0.69
55 0.66
56 0.64
57 0.6
58 0.59
59 0.58
60 0.52
61 0.54
62 0.51
63 0.46
64 0.43
65 0.4
66 0.32
67 0.27
68 0.21
69 0.12
70 0.12
71 0.09
72 0.09
73 0.1
74 0.1
75 0.08
76 0.08
77 0.08
78 0.09
79 0.1
80 0.1
81 0.12
82 0.13
83 0.17
84 0.18
85 0.19
86 0.2
87 0.21
88 0.23
89 0.25
90 0.3
91 0.27
92 0.26
93 0.25
94 0.25
95 0.24
96 0.25
97 0.21
98 0.18
99 0.19
100 0.24
101 0.27
102 0.26
103 0.27
104 0.27
105 0.28
106 0.31
107 0.3
108 0.25
109 0.21
110 0.24
111 0.24
112 0.24
113 0.22
114 0.18
115 0.17
116 0.18
117 0.2
118 0.17
119 0.16
120 0.15
121 0.17
122 0.23
123 0.31
124 0.33
125 0.33
126 0.37
127 0.38
128 0.35
129 0.37
130 0.31
131 0.27
132 0.26
133 0.26
134 0.25
135 0.24
136 0.22
137 0.18
138 0.18
139 0.13
140 0.12
141 0.1
142 0.08
143 0.08
144 0.08
145 0.08
146 0.12
147 0.14
148 0.17
149 0.19
150 0.22
151 0.26
152 0.28
153 0.31
154 0.3
155 0.31
156 0.28
157 0.29
158 0.29
159 0.25
160 0.26
161 0.27
162 0.24
163 0.22
164 0.24
165 0.2
166 0.18
167 0.18
168 0.17
169 0.18
170 0.19
171 0.23
172 0.27
173 0.28
174 0.3
175 0.35
176 0.37
177 0.33
178 0.34
179 0.31
180 0.29
181 0.31
182 0.37
183 0.42
184 0.5
185 0.59
186 0.67
187 0.72
188 0.78
189 0.83
190 0.81
191 0.77
192 0.75
193 0.75
194 0.76
195 0.8
196 0.79
197 0.8
198 0.75
199 0.77
200 0.69
201 0.61
202 0.52
203 0.43
204 0.42
205 0.33
206 0.35
207 0.27
208 0.26
209 0.25
210 0.23
211 0.23
212 0.14
213 0.15
214 0.11
215 0.1
216 0.12
217 0.13
218 0.13
219 0.13
220 0.16
221 0.22
222 0.24
223 0.27
224 0.28
225 0.26
226 0.27
227 0.28
228 0.26
229 0.21
230 0.25
231 0.26
232 0.3
233 0.39
234 0.44
235 0.45
236 0.49
237 0.55
238 0.53
239 0.53
240 0.51
241 0.52
242 0.52
243 0.58
244 0.6
245 0.63
246 0.67
247 0.71
248 0.72
249 0.72
250 0.71
251 0.71
252 0.68