Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GJ48

Protein Details
Accession A0A2I1GJ48   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
99-127AVAQEKRTQDKKRAQKKERRSIVWKVDENHydrophilic
NLS Segment(s)
PositionSequence
109-118KKRAQKKERR
Subcellular Location(s) extr 11, golg 6, mito 4, E.R. 3, nucl 1, plas 1, pero 1
Family & Domain DBs
Amino Acid Sequences MYKLNIIIIFFLCIAAIFTNAAPLNTVPQNPSSSLTARSALNLNSDASAIYHAKKRRGIIIPELDLSDSDTIRPKIIKNRMIRRNPINYNAANHSTKDAVAQEKRTQDKKRAQKKERRSIVWKVDENILFKRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.07
5 0.06
6 0.11
7 0.11
8 0.11
9 0.11
10 0.11
11 0.15
12 0.17
13 0.18
14 0.15
15 0.17
16 0.19
17 0.19
18 0.22
19 0.2
20 0.2
21 0.21
22 0.22
23 0.21
24 0.19
25 0.2
26 0.19
27 0.17
28 0.17
29 0.16
30 0.14
31 0.12
32 0.12
33 0.11
34 0.09
35 0.11
36 0.09
37 0.1
38 0.15
39 0.18
40 0.23
41 0.26
42 0.27
43 0.32
44 0.36
45 0.38
46 0.39
47 0.41
48 0.37
49 0.35
50 0.34
51 0.26
52 0.21
53 0.19
54 0.13
55 0.08
56 0.07
57 0.1
58 0.1
59 0.11
60 0.12
61 0.13
62 0.21
63 0.29
64 0.36
65 0.42
66 0.51
67 0.6
68 0.66
69 0.7
70 0.69
71 0.7
72 0.67
73 0.63
74 0.58
75 0.49
76 0.46
77 0.44
78 0.42
79 0.34
80 0.31
81 0.28
82 0.23
83 0.22
84 0.2
85 0.18
86 0.2
87 0.23
88 0.28
89 0.31
90 0.38
91 0.45
92 0.51
93 0.54
94 0.57
95 0.63
96 0.69
97 0.74
98 0.78
99 0.82
100 0.84
101 0.9
102 0.91
103 0.91
104 0.89
105 0.85
106 0.84
107 0.83
108 0.82
109 0.76
110 0.68
111 0.66
112 0.61
113 0.57