Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HGY4

Protein Details
Accession A0A2I1HGY4   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
30-87EQSGGKIRGKRNKNKNERKNKRERKISKRSTKRRKQRKMKGNMKGKRMKMKTKEKEENBasic
NLS Segment(s)
PositionSequence
34-84GKIRGKRNKNKNERKNKRERKISKRSTKRRKQRKMKGNMKGKRMKMKTKEK
Subcellular Location(s) nucl 25.5, cyto_nucl 13.833
Family & Domain DBs
Amino Acid Sequences MFDDINDLDDNLDVEMSETNDDVNIEEAEEQSGGKIRGKRNKNKNERKNKRERKISKRSTKRRKQRKMKGNMKGKRMKMKTKEKEEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.07
4 0.07
5 0.07
6 0.07
7 0.07
8 0.07
9 0.07
10 0.08
11 0.07
12 0.06
13 0.07
14 0.07
15 0.07
16 0.07
17 0.07
18 0.05
19 0.08
20 0.08
21 0.12
22 0.17
23 0.23
24 0.32
25 0.41
26 0.5
27 0.58
28 0.68
29 0.76
30 0.82
31 0.86
32 0.89
33 0.91
34 0.91
35 0.92
36 0.92
37 0.9
38 0.9
39 0.9
40 0.89
41 0.9
42 0.91
43 0.9
44 0.9
45 0.92
46 0.92
47 0.93
48 0.93
49 0.93
50 0.94
51 0.94
52 0.94
53 0.93
54 0.93
55 0.93
56 0.92
57 0.92
58 0.88
59 0.87
60 0.85
61 0.82
62 0.82
63 0.8
64 0.8
65 0.79
66 0.84
67 0.84