Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GLE2

Protein Details
Accession A0A2I1GLE2    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-42TPPYVQKILFKNKIKKRKPPKICSDCKETSHydrophilic
NLS Segment(s)
PositionSequence
24-32NKIKKRKPP
Subcellular Location(s) nucl 14.5, cyto_nucl 11, mito 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSSKNYGQKTCGTPPYVQKILFKNKIKKRKPPKICSDCKETSDSVKLSSSKVNRLEEVTNNFYENPIKKNKNNQFSIFNNAKFTLNNVSCELEYDLSKFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.56
3 0.54
4 0.49
5 0.47
6 0.49
7 0.55
8 0.6
9 0.62
10 0.64
11 0.69
12 0.78
13 0.8
14 0.83
15 0.84
16 0.86
17 0.88
18 0.88
19 0.89
20 0.89
21 0.9
22 0.84
23 0.81
24 0.74
25 0.65
26 0.59
27 0.48
28 0.41
29 0.36
30 0.31
31 0.24
32 0.23
33 0.21
34 0.19
35 0.23
36 0.22
37 0.23
38 0.28
39 0.28
40 0.26
41 0.28
42 0.29
43 0.28
44 0.31
45 0.29
46 0.24
47 0.24
48 0.23
49 0.21
50 0.24
51 0.22
52 0.21
53 0.27
54 0.32
55 0.36
56 0.47
57 0.56
58 0.6
59 0.64
60 0.63
61 0.61
62 0.58
63 0.62
64 0.57
65 0.5
66 0.44
67 0.39
68 0.37
69 0.29
70 0.3
71 0.31
72 0.27
73 0.28
74 0.27
75 0.29
76 0.27
77 0.3
78 0.3
79 0.22
80 0.21