Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3NMM7

Protein Details
Accession J3NMM7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
38-61CPSPTPSLGHRKRRKRLDVEMTLTHydrophilic
NLS Segment(s)
PositionSequence
48-52RKRRK
Subcellular Location(s) nucl 11, mito 8, cyto 6
Family & Domain DBs
Amino Acid Sequences MSEGLTSMPWAIRVAHAVEWEDGTGSRDDAWPLACALCPSPTPSLGHRKRRKRLDVEMTLTAWRKVQLATCQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.15
4 0.16
5 0.15
6 0.15
7 0.14
8 0.12
9 0.1
10 0.11
11 0.09
12 0.08
13 0.08
14 0.08
15 0.09
16 0.09
17 0.09
18 0.08
19 0.08
20 0.08
21 0.07
22 0.07
23 0.07
24 0.08
25 0.07
26 0.09
27 0.1
28 0.11
29 0.13
30 0.17
31 0.27
32 0.35
33 0.46
34 0.53
35 0.62
36 0.71
37 0.79
38 0.85
39 0.82
40 0.83
41 0.83
42 0.82
43 0.77
44 0.7
45 0.62
46 0.57
47 0.5
48 0.4
49 0.31
50 0.24
51 0.19
52 0.18
53 0.22