Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1H2K7

Protein Details
Accession A0A2I1H2K7    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
65-85FRRSMNNKRAHQKRLKKKETEBasic
156-185DVNVSGKSGKKKNERKKSGRISNQPRKGNNHydrophilic
NLS Segment(s)
PositionSequence
70-92NNKRAHQKRLKKKETEVILKKNK
162-183KSGKKKNERKKSGRISNQPRKG
Subcellular Location(s) nucl 17, cyto_nucl 11.333, mito 6.5, cyto_mito 5.666
Family & Domain DBs
Amino Acid Sequences MVVKISSELLRSSSSIRDLIEAYIDVETSWEKQERRAILKIIEKFKGNNSHFPKTTGDWAIKELFRRSMNNKRAHQKRLKKKETEVILKKNKSVITRNKIKNKVVINSSGTACSSGTADDLSDKSDNNDNNTDVDNTNTNVSSGKSGKKKNDNNTDVNVSGKSGKKKNERKKSGRISNQPRKGNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.2
4 0.2
5 0.19
6 0.19
7 0.18
8 0.15
9 0.13
10 0.11
11 0.11
12 0.09
13 0.09
14 0.09
15 0.09
16 0.13
17 0.17
18 0.17
19 0.22
20 0.28
21 0.33
22 0.38
23 0.41
24 0.4
25 0.41
26 0.48
27 0.51
28 0.5
29 0.47
30 0.42
31 0.4
32 0.43
33 0.47
34 0.43
35 0.46
36 0.47
37 0.52
38 0.51
39 0.52
40 0.49
41 0.41
42 0.43
43 0.37
44 0.32
45 0.26
46 0.28
47 0.28
48 0.27
49 0.27
50 0.23
51 0.24
52 0.24
53 0.28
54 0.32
55 0.39
56 0.46
57 0.53
58 0.57
59 0.62
60 0.68
61 0.73
62 0.76
63 0.76
64 0.78
65 0.81
66 0.83
67 0.78
68 0.74
69 0.73
70 0.7
71 0.7
72 0.66
73 0.64
74 0.65
75 0.61
76 0.57
77 0.53
78 0.48
79 0.42
80 0.43
81 0.42
82 0.42
83 0.51
84 0.58
85 0.64
86 0.67
87 0.65
88 0.63
89 0.58
90 0.54
91 0.46
92 0.42
93 0.36
94 0.32
95 0.31
96 0.25
97 0.21
98 0.17
99 0.14
100 0.11
101 0.09
102 0.06
103 0.06
104 0.06
105 0.06
106 0.06
107 0.07
108 0.09
109 0.09
110 0.09
111 0.11
112 0.16
113 0.18
114 0.2
115 0.23
116 0.21
117 0.22
118 0.23
119 0.23
120 0.18
121 0.19
122 0.16
123 0.15
124 0.16
125 0.14
126 0.13
127 0.12
128 0.12
129 0.15
130 0.17
131 0.24
132 0.3
133 0.37
134 0.46
135 0.56
136 0.64
137 0.69
138 0.77
139 0.76
140 0.73
141 0.72
142 0.68
143 0.58
144 0.51
145 0.41
146 0.32
147 0.31
148 0.32
149 0.34
150 0.36
151 0.44
152 0.53
153 0.64
154 0.73
155 0.79
156 0.84
157 0.85
158 0.9
159 0.92
160 0.92
161 0.92
162 0.92
163 0.92
164 0.92
165 0.92