Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HKP0

Protein Details
Accession A0A2I1HKP0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
61-80IFQFGIKKWGRKIRKPHGSNHydrophilic
NLS Segment(s)
PositionSequence
67-77KKWGRKIRKPH
Subcellular Location(s) mito 14, cyto 6, extr 4, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MFTFGVYCATKAGVISLTRSTSQVSELHNITISNASSWSLIDDVVEAYFKCIYNPKLNGIIFQFGIKKWGRKIRKPHGSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.16
4 0.17
5 0.18
6 0.18
7 0.18
8 0.15
9 0.17
10 0.18
11 0.18
12 0.19
13 0.19
14 0.19
15 0.19
16 0.18
17 0.17
18 0.15
19 0.13
20 0.09
21 0.08
22 0.08
23 0.08
24 0.08
25 0.07
26 0.06
27 0.05
28 0.05
29 0.05
30 0.04
31 0.04
32 0.05
33 0.04
34 0.05
35 0.07
36 0.07
37 0.08
38 0.12
39 0.16
40 0.23
41 0.25
42 0.27
43 0.33
44 0.33
45 0.34
46 0.32
47 0.31
48 0.24
49 0.24
50 0.23
51 0.16
52 0.22
53 0.23
54 0.26
55 0.32
56 0.42
57 0.49
58 0.56
59 0.68
60 0.72