Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1F2C4

Protein Details
Accession A0A2I1F2C4    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
67-86DKLRLEYIKQKRLNDKNKSKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MNVLTRSEEEILFNQLKHNARINCAPLIQEFVDCNTGKSFSVIWSCRRQLKAMNNCLKNFTTTEELDKLRLEYIKQKRLNDKNKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.26
3 0.28
4 0.29
5 0.35
6 0.31
7 0.33
8 0.38
9 0.39
10 0.34
11 0.32
12 0.29
13 0.22
14 0.24
15 0.2
16 0.16
17 0.13
18 0.13
19 0.17
20 0.16
21 0.16
22 0.13
23 0.14
24 0.13
25 0.13
26 0.12
27 0.09
28 0.15
29 0.16
30 0.2
31 0.24
32 0.27
33 0.31
34 0.32
35 0.32
36 0.33
37 0.41
38 0.47
39 0.51
40 0.58
41 0.57
42 0.56
43 0.59
44 0.52
45 0.44
46 0.35
47 0.29
48 0.25
49 0.21
50 0.25
51 0.26
52 0.26
53 0.25
54 0.25
55 0.22
56 0.2
57 0.21
58 0.19
59 0.25
60 0.34
61 0.43
62 0.48
63 0.54
64 0.62
65 0.71
66 0.79