Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1FZ00

Protein Details
Accession A0A2I1FZ00   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
5-29FLRGICTRTKCKYQHKIRKFIVCKYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 4.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045348  CPSF4/Yth1  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0003723  F:RNA binding  
GO:0098789  P:pre-mRNA cleavage required for polyadenylation  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences ICQDFLRGICTRTKCKYQHKIRKFIVCKYWLRGLCMKGEEQCEYLHEYDLSKMPKCAHYRLYGVCNSINCIYSHDKVESERCNWYDRGFCRKGLTCNKKHVKQVACQLYLTGFCPRGPSCPNGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.64
3 0.73
4 0.77
5 0.82
6 0.84
7 0.88
8 0.86
9 0.88
10 0.82
11 0.79
12 0.76
13 0.73
14 0.67
15 0.62
16 0.63
17 0.53
18 0.53
19 0.5
20 0.43
21 0.4
22 0.37
23 0.34
24 0.29
25 0.3
26 0.26
27 0.22
28 0.21
29 0.18
30 0.19
31 0.18
32 0.16
33 0.13
34 0.12
35 0.12
36 0.16
37 0.17
38 0.15
39 0.16
40 0.17
41 0.23
42 0.25
43 0.27
44 0.27
45 0.27
46 0.3
47 0.31
48 0.33
49 0.28
50 0.26
51 0.24
52 0.21
53 0.2
54 0.18
55 0.16
56 0.13
57 0.15
58 0.18
59 0.18
60 0.2
61 0.18
62 0.18
63 0.19
64 0.24
65 0.24
66 0.23
67 0.26
68 0.25
69 0.28
70 0.28
71 0.28
72 0.3
73 0.31
74 0.38
75 0.35
76 0.35
77 0.38
78 0.41
79 0.48
80 0.52
81 0.58
82 0.55
83 0.64
84 0.72
85 0.72
86 0.76
87 0.75
88 0.69
89 0.66
90 0.7
91 0.69
92 0.61
93 0.55
94 0.48
95 0.42
96 0.37
97 0.32
98 0.27
99 0.2
100 0.18
101 0.23
102 0.23
103 0.28
104 0.3