Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3P3V2

Protein Details
Accession J3P3V2    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MRAKWRKKRVRRLKRKRRKMRARSIAQSTTBasic
NLS Segment(s)
PositionSequence
3-23AKWRKKRVRRLKRKRRKMRAR
Subcellular Location(s) nucl 17.5, mito_nucl 13.666, cyto_nucl 10.333, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MRAKWRKKRVRRLKRKRRKMRARSIAQSTTTIIDSGNDTKSITYPRRHGLDIHQSITSITTVMELEDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.97
2 0.97
3 0.97
4 0.97
5 0.97
6 0.96
7 0.96
8 0.95
9 0.93
10 0.88
11 0.84
12 0.77
13 0.67
14 0.57
15 0.46
16 0.37
17 0.28
18 0.21
19 0.13
20 0.1
21 0.09
22 0.1
23 0.1
24 0.09
25 0.09
26 0.09
27 0.11
28 0.16
29 0.2
30 0.22
31 0.26
32 0.32
33 0.35
34 0.36
35 0.36
36 0.38
37 0.44
38 0.44
39 0.42
40 0.36
41 0.33
42 0.32
43 0.32
44 0.24
45 0.13
46 0.08
47 0.07
48 0.07