Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GRK0

Protein Details
Accession A0A2I1GRK0    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
78-97EDCDSMSDENKKRKEKKRNLBasic
NLS Segment(s)
PositionSequence
88-97KKRKEKKRNL
Subcellular Location(s) nucl 19, cyto_nucl 15, cyto 7
Family & Domain DBs
Amino Acid Sequences EIQYTCGDSFYDIASNDTNDSMKKLFSIVKVNNTLTCNSPIEIPYYSSRLFKEVLCFNCGVECEEHNTNHGEYFPYCEDCDSMSDENKKRKEKKRNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.15
5 0.14
6 0.12
7 0.14
8 0.13
9 0.12
10 0.11
11 0.13
12 0.15
13 0.17
14 0.25
15 0.26
16 0.31
17 0.35
18 0.36
19 0.37
20 0.36
21 0.34
22 0.27
23 0.27
24 0.22
25 0.18
26 0.18
27 0.15
28 0.16
29 0.15
30 0.15
31 0.14
32 0.16
33 0.16
34 0.17
35 0.17
36 0.16
37 0.16
38 0.14
39 0.18
40 0.2
41 0.21
42 0.22
43 0.21
44 0.2
45 0.2
46 0.2
47 0.17
48 0.12
49 0.11
50 0.14
51 0.16
52 0.17
53 0.17
54 0.18
55 0.17
56 0.17
57 0.17
58 0.14
59 0.12
60 0.17
61 0.18
62 0.18
63 0.18
64 0.18
65 0.18
66 0.17
67 0.19
68 0.18
69 0.18
70 0.22
71 0.3
72 0.37
73 0.45
74 0.53
75 0.61
76 0.67
77 0.75