Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NRL4

Protein Details
Accession J3NRL4    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-21AKKNNDKKPADKKGQGSKDDBasic
NLS Segment(s)
PositionSequence
9-14KPADKK
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043323  PIN4  
IPR046357  PPIase_dom_sf  
IPR000297  PPIase_PpiC  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF13616  Rotamase_3  
PROSITE View protein in PROSITE  
PS50198  PPIC_PPIASE_2  
Amino Acid Sequences MAKKNNDKKPADKKGQGSKDDGDKGDKKVKAAQQINVRHILCEKHSKKEEALQKIRDGTKFDEVAREFSEDKARQGGSLGWKAKGTLKAEFEAVAFSLEPSTTSSPKIGEAKTAFGYHIIMVEGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.76
4 0.7
5 0.63
6 0.61
7 0.59
8 0.52
9 0.48
10 0.43
11 0.45
12 0.48
13 0.45
14 0.39
15 0.42
16 0.45
17 0.48
18 0.48
19 0.49
20 0.5
21 0.55
22 0.56
23 0.56
24 0.51
25 0.42
26 0.39
27 0.35
28 0.29
29 0.34
30 0.33
31 0.35
32 0.38
33 0.4
34 0.39
35 0.45
36 0.49
37 0.48
38 0.52
39 0.46
40 0.44
41 0.47
42 0.48
43 0.42
44 0.37
45 0.3
46 0.28
47 0.27
48 0.25
49 0.25
50 0.23
51 0.23
52 0.21
53 0.21
54 0.17
55 0.17
56 0.24
57 0.2
58 0.2
59 0.21
60 0.2
61 0.17
62 0.18
63 0.19
64 0.17
65 0.23
66 0.24
67 0.22
68 0.22
69 0.23
70 0.27
71 0.3
72 0.27
73 0.25
74 0.26
75 0.26
76 0.26
77 0.26
78 0.21
79 0.16
80 0.14
81 0.1
82 0.08
83 0.07
84 0.07
85 0.06
86 0.07
87 0.1
88 0.13
89 0.14
90 0.15
91 0.16
92 0.17
93 0.22
94 0.26
95 0.23
96 0.27
97 0.28
98 0.3
99 0.32
100 0.32
101 0.28
102 0.23
103 0.24
104 0.17
105 0.16
106 0.13