Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HF08

Protein Details
Accession A0A2I1HF08   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MKKVNGKKIKCKRNKSGGSKDEVREBasic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, mito 6
Family & Domain DBs
Amino Acid Sequences MKKVNGKKIKCKRNKSGGSKDEVREYNDISRGKSYPNKARIESMQASMGKLRRIGIVKSDEGQNEYHANLYSHVERDLTEKLLHNMSEGHECCNMVIEIIVSESNRHQLAESINKEPCEVSNLTECIKVKADYGEDLYDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.91
4 0.86
5 0.84
6 0.81
7 0.73
8 0.7
9 0.62
10 0.55
11 0.47
12 0.43
13 0.39
14 0.38
15 0.37
16 0.31
17 0.32
18 0.29
19 0.32
20 0.36
21 0.4
22 0.43
23 0.5
24 0.52
25 0.51
26 0.54
27 0.5
28 0.51
29 0.45
30 0.37
31 0.34
32 0.29
33 0.28
34 0.28
35 0.28
36 0.21
37 0.2
38 0.19
39 0.18
40 0.19
41 0.19
42 0.21
43 0.23
44 0.22
45 0.23
46 0.24
47 0.21
48 0.2
49 0.2
50 0.16
51 0.14
52 0.13
53 0.12
54 0.1
55 0.1
56 0.09
57 0.11
58 0.1
59 0.1
60 0.1
61 0.09
62 0.09
63 0.12
64 0.12
65 0.12
66 0.13
67 0.13
68 0.14
69 0.16
70 0.15
71 0.13
72 0.12
73 0.12
74 0.18
75 0.17
76 0.18
77 0.17
78 0.17
79 0.17
80 0.17
81 0.16
82 0.09
83 0.08
84 0.06
85 0.05
86 0.06
87 0.07
88 0.05
89 0.07
90 0.07
91 0.11
92 0.11
93 0.11
94 0.11
95 0.13
96 0.18
97 0.26
98 0.29
99 0.31
100 0.33
101 0.34
102 0.34
103 0.32
104 0.27
105 0.23
106 0.2
107 0.18
108 0.22
109 0.23
110 0.24
111 0.28
112 0.28
113 0.26
114 0.29
115 0.26
116 0.22
117 0.24
118 0.25
119 0.23
120 0.26