Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HUD9

Protein Details
Accession A0A2I1HUD9   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
129-183NQVDRRRYEYRERRRSRSRSSHHRHERRRSRSRSPRRERRERRERRRNYSLTPVIBasic
NLS Segment(s)
PositionSequence
125-175AARRNQVDRRRYEYRERRRSRSRSSHHRHERRRSRSRSPRRERRERRERRR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR044822  Myb_DNA-bind_4  
Pfam View protein in Pfam  
PF13837  Myb_DNA-bind_4  
Amino Acid Sequences MAQLNAGGGIGVVNYYVTWPNDGVLSLIQYRRFFQQEFCRTPIYEQKQIWNQVAQNINLDHPNFAPTKKQCRTKWNSLKSGYENLKRLLNGNPEGFPTHTPTLHDEHFHEELSDEFWLAEPRVRAARRNQVDRRRYEYRERRRSRSRSSHHRHERRRSRSRSPRRERRERRERRRNYSLTPVIETDTVIIIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.05
3 0.09
4 0.09
5 0.11
6 0.12
7 0.12
8 0.13
9 0.13
10 0.12
11 0.1
12 0.12
13 0.14
14 0.17
15 0.21
16 0.21
17 0.23
18 0.27
19 0.3
20 0.28
21 0.32
22 0.4
23 0.45
24 0.49
25 0.5
26 0.48
27 0.45
28 0.48
29 0.51
30 0.47
31 0.46
32 0.42
33 0.46
34 0.5
35 0.53
36 0.52
37 0.45
38 0.39
39 0.37
40 0.39
41 0.33
42 0.28
43 0.25
44 0.24
45 0.23
46 0.22
47 0.17
48 0.14
49 0.16
50 0.14
51 0.14
52 0.21
53 0.24
54 0.34
55 0.4
56 0.49
57 0.51
58 0.61
59 0.69
60 0.73
61 0.77
62 0.76
63 0.76
64 0.7
65 0.69
66 0.62
67 0.61
68 0.56
69 0.5
70 0.44
71 0.38
72 0.37
73 0.33
74 0.31
75 0.27
76 0.26
77 0.24
78 0.23
79 0.21
80 0.2
81 0.21
82 0.2
83 0.17
84 0.17
85 0.15
86 0.14
87 0.15
88 0.17
89 0.19
90 0.19
91 0.2
92 0.16
93 0.19
94 0.2
95 0.19
96 0.16
97 0.13
98 0.13
99 0.13
100 0.11
101 0.06
102 0.05
103 0.06
104 0.07
105 0.07
106 0.09
107 0.08
108 0.1
109 0.16
110 0.17
111 0.21
112 0.27
113 0.37
114 0.42
115 0.51
116 0.58
117 0.62
118 0.69
119 0.7
120 0.72
121 0.69
122 0.67
123 0.68
124 0.7
125 0.72
126 0.75
127 0.77
128 0.78
129 0.82
130 0.85
131 0.84
132 0.84
133 0.83
134 0.83
135 0.85
136 0.87
137 0.88
138 0.9
139 0.9
140 0.91
141 0.92
142 0.91
143 0.92
144 0.9
145 0.9
146 0.9
147 0.91
148 0.91
149 0.92
150 0.92
151 0.92
152 0.95
153 0.95
154 0.95
155 0.95
156 0.95
157 0.95
158 0.95
159 0.95
160 0.93
161 0.93
162 0.88
163 0.84
164 0.83
165 0.8
166 0.72
167 0.65
168 0.57
169 0.49
170 0.42
171 0.36
172 0.26