Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GAG2

Protein Details
Accession A0A2I1GAG2    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MKDKYRYHVKQEKNQNVTRKQRKDSKVEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 3, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MKDKYRYHVKQEKNQNVTRKQRKDSKVELVNSDTPIGEFEMTMEDIYLVIIAWGDIDALDSDIKDNKNIIIVGKDSLEKAYTPTLVTRPQFYDNMLQGRDKISQEVMERVNERYRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.8
4 0.82
5 0.83
6 0.8
7 0.78
8 0.8
9 0.8
10 0.79
11 0.77
12 0.76
13 0.73
14 0.68
15 0.63
16 0.58
17 0.54
18 0.47
19 0.4
20 0.29
21 0.21
22 0.19
23 0.16
24 0.1
25 0.07
26 0.06
27 0.07
28 0.07
29 0.07
30 0.06
31 0.05
32 0.05
33 0.05
34 0.05
35 0.03
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.03
45 0.03
46 0.04
47 0.03
48 0.04
49 0.07
50 0.08
51 0.08
52 0.08
53 0.08
54 0.1
55 0.1
56 0.1
57 0.09
58 0.1
59 0.1
60 0.11
61 0.11
62 0.1
63 0.1
64 0.1
65 0.09
66 0.1
67 0.11
68 0.11
69 0.11
70 0.13
71 0.16
72 0.21
73 0.22
74 0.24
75 0.25
76 0.28
77 0.28
78 0.29
79 0.32
80 0.31
81 0.34
82 0.32
83 0.3
84 0.27
85 0.29
86 0.31
87 0.26
88 0.23
89 0.2
90 0.23
91 0.25
92 0.29
93 0.29
94 0.3
95 0.31
96 0.33