Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HKN0

Protein Details
Accession A0A2I1HKN0   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
64-90ATTKSFLRIRWHKKKKKQEIELIPYQRHydrophilic
NLS Segment(s)
PositionSequence
73-80RWHKKKKK
Subcellular Location(s) cyto_nucl 13, nucl 12.5, cyto 10.5, mito 2
Family & Domain DBs
Amino Acid Sequences MEESKSNEYEFVKNVVNKEPSTGKFDKILKISKNGKAEKQVEKGDFNNVDPAKRVDETLLAGYATTKSFLRIRWHKKKKKQEIELIPYQRYVAPPILSSEKVIGKTVSPKYEELTNVFRKCGEEMEWEATEMQITEKFEGVREWVTEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.38
4 0.34
5 0.37
6 0.4
7 0.36
8 0.41
9 0.41
10 0.35
11 0.38
12 0.41
13 0.42
14 0.41
15 0.46
16 0.41
17 0.48
18 0.53
19 0.53
20 0.58
21 0.57
22 0.55
23 0.57
24 0.6
25 0.59
26 0.58
27 0.57
28 0.51
29 0.5
30 0.47
31 0.45
32 0.39
33 0.33
34 0.34
35 0.29
36 0.27
37 0.25
38 0.26
39 0.21
40 0.2
41 0.2
42 0.13
43 0.13
44 0.14
45 0.13
46 0.12
47 0.08
48 0.08
49 0.08
50 0.08
51 0.07
52 0.07
53 0.06
54 0.08
55 0.1
56 0.13
57 0.22
58 0.3
59 0.41
60 0.51
61 0.62
62 0.7
63 0.78
64 0.86
65 0.89
66 0.89
67 0.87
68 0.86
69 0.84
70 0.82
71 0.8
72 0.73
73 0.62
74 0.52
75 0.45
76 0.36
77 0.27
78 0.22
79 0.16
80 0.13
81 0.13
82 0.16
83 0.18
84 0.18
85 0.18
86 0.18
87 0.18
88 0.19
89 0.19
90 0.17
91 0.15
92 0.22
93 0.26
94 0.26
95 0.26
96 0.26
97 0.27
98 0.3
99 0.31
100 0.27
101 0.31
102 0.36
103 0.35
104 0.35
105 0.34
106 0.31
107 0.31
108 0.29
109 0.24
110 0.2
111 0.23
112 0.28
113 0.28
114 0.27
115 0.26
116 0.23
117 0.2
118 0.16
119 0.13
120 0.11
121 0.12
122 0.13
123 0.15
124 0.15
125 0.16
126 0.17
127 0.18
128 0.18