Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1F2P9

Protein Details
Accession A0A2I1F2P9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
100-120VPNRTTSRSKYGTKKPKATTKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005679  Ribosomal_S12_bac  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
CDD cd03368  Ribosomal_S12  
Amino Acid Sequences MRGIRKPGTKLSKSPALEGNFQKKGVCNKIYTTKPKKPNSASRKVARVKLSTGKFVTAYIPGEGHNLSEHCVVLVRGGRVKDLPGVRYHLIRGAYDFAGVPNRTTSRSKYGTKKPKATTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.55
3 0.49
4 0.51
5 0.52
6 0.53
7 0.47
8 0.46
9 0.43
10 0.41
11 0.45
12 0.46
13 0.42
14 0.36
15 0.38
16 0.46
17 0.53
18 0.59
19 0.61
20 0.62
21 0.68
22 0.73
23 0.77
24 0.76
25 0.79
26 0.78
27 0.79
28 0.78
29 0.73
30 0.75
31 0.71
32 0.69
33 0.63
34 0.55
35 0.5
36 0.49
37 0.46
38 0.41
39 0.37
40 0.32
41 0.27
42 0.25
43 0.22
44 0.15
45 0.14
46 0.1
47 0.1
48 0.09
49 0.1
50 0.09
51 0.08
52 0.08
53 0.07
54 0.08
55 0.08
56 0.08
57 0.07
58 0.07
59 0.07
60 0.08
61 0.11
62 0.1
63 0.13
64 0.13
65 0.14
66 0.14
67 0.15
68 0.18
69 0.18
70 0.19
71 0.19
72 0.23
73 0.24
74 0.25
75 0.25
76 0.23
77 0.22
78 0.2
79 0.2
80 0.19
81 0.17
82 0.17
83 0.16
84 0.13
85 0.19
86 0.19
87 0.18
88 0.19
89 0.21
90 0.24
91 0.27
92 0.31
93 0.33
94 0.4
95 0.47
96 0.52
97 0.61
98 0.69
99 0.75
100 0.8