Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HLJ4

Protein Details
Accession A0A2I1HLJ4    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
24-47ERESQLSKDRERKRKKVEEETEEQAcidic
NLS Segment(s)
PositionSequence
14-15RK
32-39DRERKRKK
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MNSQPISDEALRKRKRGAIETADERESQLSKDRERKRKKVEEETEEQRVKWLEYQPELSSVDRKLLKNFCKKMDKLRHVLCPVCNESCPSIVLVNGKCRRCYSEKIMPNKFSAENNMDPGEVPEEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.55
3 0.54
4 0.54
5 0.52
6 0.56
7 0.6
8 0.59
9 0.55
10 0.48
11 0.43
12 0.36
13 0.29
14 0.22
15 0.23
16 0.24
17 0.29
18 0.39
19 0.48
20 0.57
21 0.66
22 0.75
23 0.77
24 0.83
25 0.85
26 0.86
27 0.85
28 0.81
29 0.78
30 0.74
31 0.72
32 0.63
33 0.54
34 0.45
35 0.37
36 0.3
37 0.27
38 0.26
39 0.2
40 0.21
41 0.24
42 0.22
43 0.24
44 0.25
45 0.21
46 0.19
47 0.16
48 0.19
49 0.2
50 0.2
51 0.23
52 0.28
53 0.35
54 0.42
55 0.46
56 0.48
57 0.52
58 0.53
59 0.59
60 0.63
61 0.62
62 0.6
63 0.61
64 0.61
65 0.57
66 0.59
67 0.5
68 0.45
69 0.43
70 0.36
71 0.32
72 0.27
73 0.25
74 0.23
75 0.21
76 0.16
77 0.13
78 0.12
79 0.17
80 0.18
81 0.26
82 0.32
83 0.34
84 0.35
85 0.37
86 0.42
87 0.42
88 0.47
89 0.46
90 0.5
91 0.55
92 0.63
93 0.69
94 0.66
95 0.63
96 0.59
97 0.53
98 0.45
99 0.44
100 0.41
101 0.35
102 0.36
103 0.35
104 0.31
105 0.29
106 0.29