Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HJU6

Protein Details
Accession A0A2I1HJU6   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
69-94MLNRKAAARLRQKKKKEIKELQDSNIHydrophilic
NLS Segment(s)
PositionSequence
64-85NERKRMLNRKAAARLRQKKKKE
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
Amino Acid Sequences MEKKESYEISEDNPLLKTSVVSTKDSSSEDIQQNQSLCKISSSSSRSSKFSNNIDKKILQNERNERKRMLNRKAAARLRQKKKKEIKELQDSNISLRDEIEQVESIIMKLRQQIMDLEIKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.21
3 0.19
4 0.16
5 0.13
6 0.2
7 0.21
8 0.22
9 0.24
10 0.25
11 0.27
12 0.28
13 0.28
14 0.24
15 0.28
16 0.29
17 0.31
18 0.32
19 0.32
20 0.31
21 0.29
22 0.28
23 0.22
24 0.19
25 0.15
26 0.14
27 0.12
28 0.19
29 0.22
30 0.27
31 0.32
32 0.34
33 0.35
34 0.37
35 0.41
36 0.39
37 0.43
38 0.48
39 0.46
40 0.47
41 0.48
42 0.47
43 0.43
44 0.46
45 0.45
46 0.39
47 0.41
48 0.47
49 0.55
50 0.59
51 0.6
52 0.54
53 0.55
54 0.6
55 0.63
56 0.61
57 0.59
58 0.57
59 0.62
60 0.69
61 0.67
62 0.66
63 0.67
64 0.7
65 0.72
66 0.77
67 0.76
68 0.78
69 0.82
70 0.84
71 0.84
72 0.83
73 0.82
74 0.83
75 0.82
76 0.75
77 0.71
78 0.62
79 0.53
80 0.48
81 0.39
82 0.28
83 0.24
84 0.21
85 0.16
86 0.16
87 0.16
88 0.12
89 0.12
90 0.12
91 0.12
92 0.1
93 0.14
94 0.14
95 0.13
96 0.17
97 0.21
98 0.21
99 0.23
100 0.24
101 0.24
102 0.31