Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HW90

Protein Details
Accession A0A2I1HW90    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-41WESNEIKQKKATRSKPKGNRVGQKMVHydrophilic
NLS Segment(s)
PositionSequence
24-33KKATRSKPKG
Subcellular Location(s) nucl 10.5, cyto_nucl 9.833, mito 6, cyto 6, cyto_pero 4.999, pero 2.5
Family & Domain DBs
Amino Acid Sequences MPLNHEKDPERLDNQWESNEIKQKKATRSKPKGNRVGQKMVIVRSNGDNHWDTTGTPPGGNQTKWWYIIGIQNPSKKNHTVTIRPHHSDHMVIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.39
3 0.36
4 0.34
5 0.35
6 0.42
7 0.38
8 0.35
9 0.4
10 0.45
11 0.52
12 0.59
13 0.63
14 0.65
15 0.74
16 0.81
17 0.85
18 0.88
19 0.88
20 0.86
21 0.85
22 0.8
23 0.77
24 0.68
25 0.63
26 0.55
27 0.47
28 0.41
29 0.32
30 0.27
31 0.23
32 0.23
33 0.17
34 0.18
35 0.17
36 0.15
37 0.16
38 0.15
39 0.13
40 0.13
41 0.17
42 0.14
43 0.13
44 0.13
45 0.17
46 0.2
47 0.2
48 0.19
49 0.21
50 0.23
51 0.25
52 0.25
53 0.2
54 0.19
55 0.24
56 0.27
57 0.3
58 0.32
59 0.38
60 0.41
61 0.44
62 0.46
63 0.44
64 0.42
65 0.42
66 0.45
67 0.47
68 0.54
69 0.61
70 0.66
71 0.67
72 0.66
73 0.62
74 0.57