Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GDK9

Protein Details
Accession A0A2I1GDK9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-29VTSMPPQTPFRCKRKKEKKLIQKAETADHydrophilic
NLS Segment(s)
PositionSequence
15-19RKKEK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVTSMPPQTPFRCKRKKEKKLIQKAETADFFINKASPDQKKLFLQSSLEDLEASGSVSKPKYTPIIKEKKTKHIKDTKEEATYIITGYQPTGPALANVNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.83
3 0.88
4 0.89
5 0.91
6 0.92
7 0.92
8 0.95
9 0.88
10 0.83
11 0.76
12 0.7
13 0.6
14 0.51
15 0.41
16 0.31
17 0.26
18 0.2
19 0.17
20 0.12
21 0.13
22 0.17
23 0.18
24 0.23
25 0.26
26 0.29
27 0.3
28 0.33
29 0.33
30 0.28
31 0.27
32 0.22
33 0.23
34 0.2
35 0.17
36 0.14
37 0.11
38 0.1
39 0.08
40 0.08
41 0.05
42 0.04
43 0.06
44 0.07
45 0.08
46 0.08
47 0.1
48 0.16
49 0.18
50 0.25
51 0.33
52 0.44
53 0.49
54 0.58
55 0.61
56 0.66
57 0.74
58 0.72
59 0.72
60 0.71
61 0.73
62 0.72
63 0.75
64 0.71
65 0.64
66 0.59
67 0.5
68 0.43
69 0.36
70 0.27
71 0.2
72 0.15
73 0.12
74 0.13
75 0.13
76 0.11
77 0.11
78 0.12
79 0.11
80 0.11