Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1G021

Protein Details
Accession A0A2I1G021    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
52-76QGEPKKDPPKDEPKKIQNLKKKRNLBasic
NLS Segment(s)
PositionSequence
49-76RAPQGEPKKDPPKDEPKKIQNLKKKRNL
Subcellular Location(s) extr 7, E.R. 6, mito 5, plas 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPRVGFKFKHIKHTIVLILVLSVILFIIVNFAPTNDGIKNPTGSILQKRAPQGEPKKDPPKDEPKKIQNLKKKRNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.36
3 0.33
4 0.22
5 0.18
6 0.15
7 0.12
8 0.07
9 0.04
10 0.03
11 0.02
12 0.02
13 0.02
14 0.04
15 0.04
16 0.05
17 0.05
18 0.05
19 0.06
20 0.06
21 0.09
22 0.07
23 0.08
24 0.09
25 0.1
26 0.1
27 0.1
28 0.11
29 0.1
30 0.12
31 0.16
32 0.19
33 0.22
34 0.25
35 0.28
36 0.3
37 0.31
38 0.39
39 0.44
40 0.5
41 0.54
42 0.6
43 0.67
44 0.67
45 0.7
46 0.69
47 0.71
48 0.71
49 0.74
50 0.75
51 0.74
52 0.81
53 0.86
54 0.87
55 0.86
56 0.87