Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HXK7

Protein Details
Accession A0A2I1HXK7    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-31GKVNRKHFDNNDPHKKKRKTLTFNQKKELCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR007889  HTH_Psq  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF04218  CENP-B_N  
Amino Acid Sequences MGKVNRKHFDNNDPHKKKRKTLTFNQKKELCEKHRDQNLSGIQLAKEYEISDSAVSDILK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.81
4 0.79
5 0.78
6 0.78
7 0.75
8 0.79
9 0.82
10 0.82
11 0.83
12 0.83
13 0.77
14 0.68
15 0.66
16 0.63
17 0.57
18 0.54
19 0.52
20 0.52
21 0.55
22 0.56
23 0.5
24 0.49
25 0.47
26 0.41
27 0.38
28 0.31
29 0.24
30 0.23
31 0.22
32 0.15
33 0.12
34 0.1
35 0.1
36 0.09
37 0.11
38 0.1
39 0.1
40 0.1