Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HM86

Protein Details
Accession A0A2I1HM86   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
63-82KSTATTKKTRNTTNTKKTKSHydrophilic
NLS Segment(s)
PositionSequence
77-94TKKTKSIMTAKKIKKARI
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 7
Family & Domain DBs
Amino Acid Sequences MAKAYKTVMGLLEYEYLLFESMKTIKDFMWSKGRSKKMTMRMINSPTGSVKKIKSTVTTKKTKSTATTKKTRNTTNTKKTKSIMTAKKIKKARI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.09
5 0.08
6 0.07
7 0.08
8 0.1
9 0.12
10 0.12
11 0.13
12 0.13
13 0.2
14 0.22
15 0.23
16 0.31
17 0.31
18 0.37
19 0.45
20 0.51
21 0.46
22 0.5
23 0.54
24 0.53
25 0.61
26 0.59
27 0.55
28 0.55
29 0.56
30 0.53
31 0.45
32 0.36
33 0.28
34 0.25
35 0.22
36 0.19
37 0.17
38 0.18
39 0.21
40 0.22
41 0.26
42 0.32
43 0.41
44 0.46
45 0.53
46 0.52
47 0.56
48 0.58
49 0.54
50 0.53
51 0.54
52 0.56
53 0.55
54 0.63
55 0.63
56 0.68
57 0.72
58 0.74
59 0.72
60 0.72
61 0.75
62 0.76
63 0.8
64 0.78
65 0.76
66 0.71
67 0.69
68 0.67
69 0.67
70 0.66
71 0.65
72 0.69
73 0.7
74 0.77