Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HXD1

Protein Details
Accession A0A2I1HXD1    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-27IGAPPKPSAKPRKPSRILSSLHydrophilic
NLS Segment(s)
PositionSequence
15-19AKPRK
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences MMKLTTIGAPPKPSAKPRKPSRILSSLENNESFLNKEQQNENAKNKTNLELLTYEDQSKKNGNDLTSYSPGYFDFNTTILPYTQFLIVLSTVLKNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.55
3 0.62
4 0.69
5 0.78
6 0.8
7 0.83
8 0.81
9 0.79
10 0.72
11 0.67
12 0.66
13 0.6
14 0.56
15 0.47
16 0.4
17 0.33
18 0.3
19 0.26
20 0.2
21 0.2
22 0.18
23 0.2
24 0.21
25 0.27
26 0.35
27 0.38
28 0.42
29 0.41
30 0.42
31 0.42
32 0.42
33 0.37
34 0.31
35 0.26
36 0.21
37 0.17
38 0.17
39 0.17
40 0.17
41 0.17
42 0.17
43 0.18
44 0.18
45 0.21
46 0.19
47 0.21
48 0.23
49 0.22
50 0.22
51 0.25
52 0.29
53 0.28
54 0.28
55 0.23
56 0.21
57 0.21
58 0.21
59 0.18
60 0.14
61 0.13
62 0.12
63 0.13
64 0.13
65 0.14
66 0.12
67 0.13
68 0.12
69 0.12
70 0.12
71 0.12
72 0.11
73 0.11
74 0.11
75 0.1
76 0.1