Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NGD1

Protein Details
Accession J3NGD1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
64-83DPDSCCCPRGRNCCNRCNTCHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, E.R. 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MKYSPILFCLGLAGVAFAAPQPADTTTTGEVVQRADGSFSLKPRFADLDPRQGPCLECPCTGWDPDSCCCPRGRNCCNRCNTCA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.04
5 0.04
6 0.04
7 0.04
8 0.05
9 0.06
10 0.09
11 0.1
12 0.13
13 0.13
14 0.14
15 0.14
16 0.13
17 0.13
18 0.11
19 0.11
20 0.09
21 0.08
22 0.07
23 0.07
24 0.1
25 0.1
26 0.13
27 0.14
28 0.15
29 0.15
30 0.16
31 0.19
32 0.16
33 0.25
34 0.25
35 0.34
36 0.35
37 0.36
38 0.36
39 0.34
40 0.34
41 0.28
42 0.31
43 0.24
44 0.21
45 0.22
46 0.25
47 0.26
48 0.26
49 0.24
50 0.21
51 0.22
52 0.24
53 0.3
54 0.27
55 0.27
56 0.28
57 0.34
58 0.4
59 0.46
60 0.55
61 0.58
62 0.65
63 0.72
64 0.8