Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1FSW7

Protein Details
Accession A0A2I1FSW7    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-49IVRLLTINRQRRPRRKCNAFKIYRTTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
Amino Acid Sequences MNYGVQIRSTIRPPFPPLITIQDIVRLLTINRQRRPRRKCNAFKIYRTTTIFHMQINNNILPISHDYFRSITSVNWDSEAPDVKKIYRGLARDTNTYYNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.39
4 0.36
5 0.37
6 0.37
7 0.33
8 0.27
9 0.26
10 0.25
11 0.23
12 0.21
13 0.14
14 0.12
15 0.18
16 0.26
17 0.3
18 0.36
19 0.46
20 0.55
21 0.65
22 0.74
23 0.78
24 0.81
25 0.83
26 0.87
27 0.88
28 0.89
29 0.86
30 0.82
31 0.79
32 0.72
33 0.67
34 0.59
35 0.5
36 0.42
37 0.39
38 0.34
39 0.27
40 0.28
41 0.22
42 0.24
43 0.25
44 0.22
45 0.18
46 0.17
47 0.16
48 0.13
49 0.16
50 0.15
51 0.13
52 0.13
53 0.15
54 0.16
55 0.17
56 0.17
57 0.14
58 0.11
59 0.17
60 0.2
61 0.18
62 0.19
63 0.19
64 0.18
65 0.2
66 0.27
67 0.21
68 0.23
69 0.24
70 0.23
71 0.29
72 0.29
73 0.33
74 0.32
75 0.33
76 0.36
77 0.43
78 0.46
79 0.46
80 0.5