Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HH14

Protein Details
Accession A0A2I1HH14    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
55-77IIKEKDRTYKNRRPKINKFDRTCHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.333, nucl 11.5, cyto 11, mito_nucl 6.998
Family & Domain DBs
InterPro View protein in InterPro  
IPR001305  HSP_DnaJ_Cys-rich_dom  
IPR036410  HSP_DnaJ_Cys-rich_dom_sf  
Gene Ontology GO:0031072  F:heat shock protein binding  
GO:0051082  F:unfolded protein binding  
Pfam View protein in Pfam  
PF00684  DnaJ_CXXCXGXG  
CDD cd10719  DnaJ_zf  
Amino Acid Sequences MAIAEPIEVEVGKEGAVKICSNCDGSGVIVLLRTFGPMVQEFQQPCDTCGGEGEIIKEKDRTYKNRRPKINKFDRTCADVVAPQEEIDETVSREAEEEKMQQREEQRKKNFIHSIVNIFKSLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.12
4 0.13
5 0.13
6 0.16
7 0.18
8 0.19
9 0.18
10 0.16
11 0.15
12 0.14
13 0.14
14 0.12
15 0.1
16 0.09
17 0.08
18 0.08
19 0.07
20 0.07
21 0.06
22 0.06
23 0.09
24 0.08
25 0.11
26 0.13
27 0.18
28 0.17
29 0.2
30 0.25
31 0.23
32 0.23
33 0.23
34 0.21
35 0.16
36 0.16
37 0.14
38 0.1
39 0.1
40 0.11
41 0.14
42 0.14
43 0.15
44 0.16
45 0.15
46 0.21
47 0.26
48 0.33
49 0.38
50 0.46
51 0.56
52 0.64
53 0.73
54 0.76
55 0.81
56 0.83
57 0.85
58 0.85
59 0.8
60 0.79
61 0.72
62 0.67
63 0.57
64 0.47
65 0.37
66 0.29
67 0.25
68 0.19
69 0.16
70 0.11
71 0.11
72 0.1
73 0.1
74 0.09
75 0.09
76 0.08
77 0.09
78 0.09
79 0.09
80 0.09
81 0.1
82 0.1
83 0.12
84 0.17
85 0.21
86 0.25
87 0.26
88 0.29
89 0.37
90 0.46
91 0.53
92 0.58
93 0.61
94 0.66
95 0.69
96 0.75
97 0.73
98 0.67
99 0.66
100 0.61
101 0.62
102 0.6
103 0.59