Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1H0F6

Protein Details
Accession A0A2I1H0F6   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
127-150PQIIPGRKTKKIGKKEHNLSKNVLHydrophilic
NLS Segment(s)
PositionSequence
99-111KRRKTEGSGRKRK
133-141RKTKKIGKK
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences METITPNSNLTIEYSELNKNVEDDITTFINFLEEIKEDYSNGCAQLHTALNKFAERYKAAKLKSIPRLVSFLYDINRELDPAVNIRSGSMIRVQVESVKRRKTEGSGRKRKPFSITNNKENLENSDPQIIPGRKTKKIGKKEHNLSKNVLKNQLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.2
4 0.21
5 0.19
6 0.17
7 0.17
8 0.15
9 0.13
10 0.11
11 0.14
12 0.14
13 0.14
14 0.13
15 0.12
16 0.12
17 0.11
18 0.1
19 0.08
20 0.07
21 0.09
22 0.11
23 0.11
24 0.11
25 0.12
26 0.14
27 0.13
28 0.13
29 0.12
30 0.1
31 0.1
32 0.13
33 0.15
34 0.15
35 0.15
36 0.16
37 0.17
38 0.17
39 0.18
40 0.17
41 0.18
42 0.18
43 0.2
44 0.25
45 0.29
46 0.29
47 0.34
48 0.36
49 0.41
50 0.47
51 0.5
52 0.44
53 0.4
54 0.42
55 0.36
56 0.33
57 0.26
58 0.2
59 0.15
60 0.15
61 0.14
62 0.14
63 0.13
64 0.12
65 0.11
66 0.09
67 0.08
68 0.09
69 0.09
70 0.08
71 0.08
72 0.08
73 0.09
74 0.08
75 0.08
76 0.1
77 0.11
78 0.11
79 0.11
80 0.11
81 0.15
82 0.2
83 0.27
84 0.31
85 0.34
86 0.34
87 0.36
88 0.38
89 0.39
90 0.45
91 0.49
92 0.54
93 0.59
94 0.67
95 0.74
96 0.75
97 0.72
98 0.68
99 0.66
100 0.65
101 0.66
102 0.66
103 0.65
104 0.68
105 0.66
106 0.61
107 0.54
108 0.5
109 0.43
110 0.37
111 0.31
112 0.31
113 0.3
114 0.29
115 0.37
116 0.32
117 0.31
118 0.37
119 0.42
120 0.41
121 0.47
122 0.56
123 0.57
124 0.66
125 0.74
126 0.76
127 0.8
128 0.86
129 0.9
130 0.88
131 0.82
132 0.77
133 0.76
134 0.74
135 0.7