Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1H9T7

Protein Details
Accession A0A2I1H9T7    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
76-109DIVLHKKERNSKIRQQWHCKKCGQLKHYQKNCNAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, mito 3
Family & Domain DBs
Amino Acid Sequences MLNTQEVKFYVRLISSRWYQENKDVSNKPFIVADKFNNPSAIIKSDIVNNYLCAINKENSENKVESDDESEEELGDIVLHKKERNSKIRQQWHCKKCGQLKHYQKNCNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.32
4 0.36
5 0.37
6 0.38
7 0.45
8 0.49
9 0.48
10 0.51
11 0.51
12 0.48
13 0.51
14 0.49
15 0.42
16 0.37
17 0.35
18 0.31
19 0.29
20 0.29
21 0.28
22 0.3
23 0.3
24 0.28
25 0.27
26 0.24
27 0.23
28 0.21
29 0.17
30 0.15
31 0.15
32 0.18
33 0.18
34 0.18
35 0.16
36 0.14
37 0.13
38 0.13
39 0.13
40 0.11
41 0.12
42 0.12
43 0.13
44 0.16
45 0.18
46 0.18
47 0.22
48 0.2
49 0.18
50 0.19
51 0.19
52 0.16
53 0.16
54 0.15
55 0.13
56 0.14
57 0.13
58 0.11
59 0.1
60 0.09
61 0.06
62 0.05
63 0.05
64 0.06
65 0.09
66 0.1
67 0.11
68 0.16
69 0.26
70 0.35
71 0.43
72 0.5
73 0.58
74 0.67
75 0.76
76 0.82
77 0.84
78 0.86
79 0.85
80 0.84
81 0.79
82 0.78
83 0.77
84 0.77
85 0.72
86 0.72
87 0.75
88 0.79
89 0.83